User:Stevey7788

From Wikipedia, the free encyclopedia
Jump to navigation Jump to search
File:Wikistress3D 1 v3.jpg
Wikistress level 1 is good for your Wikihealth
Ongoing projects: WikiVocabSwadesh lists

Hello, this is Script error: No such module "user".! But you can just call me "Steve". I am a scientist, naturalist, linguist, and Wikipediholic who is eager to document Earth's astounding diversity on Wikipedia as we strive to build the world's largest free online encyclopedia that anyone can edit.

Most of Wikipedia's articles on languages and linguistics were created, expanded, cleaned up, and maintained by me and former admin Template:Noping. We are to languages as Template:Noping is to living species.

I'm expanding and improving Wikipedia whenever I can, and have a variety of interests here. Currently, I am particularly interested in the languages of Southeast Asia and Mesoamerica.

Wikipedia is not just one of the best reference tools ever created — it's a great place where everybody can get together, form a community, and write an online encyclopedia together. Although Wikipedia is a great place on the Internet, it's not 100% perfect. But let the encyclopedia writing go on.

Some of Wikipedia's pillars

Some of my current tasks on Wikipedia include:

  • The usual task of reading, writing, and rewriting articles. I do mainly the cleanup, grammar fixes, section moving, racist tone check/cleanup, and other work.
  • RC patroling, sometimes new page patroling
  • Creating redirects and disambiguation pages. Currently, I mainly split or merge pages.
  • Patroling the Sandbox -- raking out content, putting headers back, fishing out offensive content, checking for vandalism
  • Dealing with vandals and warning them
  • Welcoming new users and being part of the Kindness Campaign

Anyways, please feel free to edit or improve my page any way you'd like. I'd really be pleased if someone would help re-organize my page for me. :)

Portal

Script error: No such module "userbox". Template:Userbox Wikimania 2012 Template:Userbox Wikimania 2014
Template:User article count ranking User:Aervanath/Trifecta Template:User Wikimaniac
Template:User AIW Template:User Ten Year Society User:Qwfp/Userboxes/Pro-admin but not for me

(Excited about Wikimania 2019 in Sweden? Me too. See you there soon!)

Stats

File:Encyclopaedia Britannica 15 with 2002.jpg
We are here to build an encyclopedia. This is my (and our) first and foremost goal. That is why we are here as Wikipedians. Everything else is secondary.

As of August 2005, my total edits amounted to approximately 4500 edits. [1]

I am an early Wikipedian. My first edit was on 07:17 UTC, 13 February 2005. As of 15 October 2005, I was ranked #709 in terms of total number of edits.

May 2019:

June 2018:

February 2018:

December 2017:

January 2017:

What I've done on Wikipedia

A lot to do, and more to do. All voluntary and often when I'm bored.

Contributions list

Used to be mainly minor edits and tedious work. Due to the images I have uploaded recently, you may see my contributions list clogged up with uploaded images.

Before April 2005, redirects were marked as minor edits.

A few examples of the work I've done on Wikipedia

As of now I'm doing lots of work on linguistics and languages.

Redirects are cheap, fun, and
easier than votes for deletion!

Other stuff I had done:

  • Massive stub-sorting
  • Patroling the Sandbox
  • Welcoming new users
  • Warning vandals
  • The map project

Stevey7788's map project

The big map project some of you noticed I have launched on Wikipedia:

Awards

File:Original Barnstar Hires.png The Original Barnstar
Thank You for editing Kra–Dai languages Jkrn111 (talk) 13:54, 3 June 2018 (UTC)

File:Black and white drawing of a man's arm flexing.jpg

I, FP, in my official capacity as nobody-in-particular, hereby bestow upon you, Stevey7788, the mighty and presigious Atlas Award for your dedicated and ongoing work to ensure that one of Wikipedia's most visible pages — the Sandbox — is sanitary, inoffensive, tidy and welcoming to new Wikipedians.

"The Atlas Award For Raking the Sandbox Clean may be awarded to those who have gone above and beyond the call of duty in fishing disgusting and unwanted items from the Wikipedia sandbox. The Atlas award is named after Charles Atlas and is taken from his 'they kicked sand in my face' advertisement, and is in no way merely a masculine image. It is a symbol of self-empowerment. Charles Atlas was once a self-styled 98-pound weakling, and through his own diligence and effort, became a very succesful businessman and body builder. And his business empire began with the ad that this image is from."

Well done. -- FP <talk><edits> 06:44, May 12, 2005 (UTC)

File:Asia medal.svg The Asian Month Barnstar
Thanks for your great contribution in Wikipedia Asian Month 2015! --AddisWang (talk) 19:50, 17 December 2015 (UTC)
File:Rosetta Barnstar Hires.png The Rosetta Barnstar
For all your work in the area of South East Asian linguistics. Donald Trung (Talk) (Articles) Respect mobile users. 23:25, 13 February 2018 (UTC)

My beginnings on Wikipedia

Even though I wasn't ever welcomed, I was welcoming others later!

As a newbie on Wiki, I was amused when somebody wrote a short autobiography on my user page: All about Steve the Vandal

Stevey7788 on Wiktionary

File:Wiktionary-logo-en.png
Wikipedia's lexical companion

I am also a very active Wiktionarian. Lexical companions to online encyclopedias can really be quite fun.

Toolbox

This is a toolbox containing various resources and links. Please improve and expand it for me if you'd like to — this is not a "no-edit" zone.

Useful links:

ADMINISTRATORS
GUIDELISTDISPUTEVFDRCCSDDELBLKIFDRFDVPCLEANNEWRFAREFPNAMWAREQ[2]

Current time:

Current time: Thursday, July 2, 2026, 08:07 (UTC) Current week: 27 Number of articles on English Wikipedia: 2,835,844

Odds and ends

Proposed Wikipedia mascot:

File:Wikipedesketch.png
Go boy! Edit boy!

Boxes Template:User WikiProject Languages Script error: No such module "userbox". Template:User article count ranking

File:PD-icon.svg Released into public domain File:PD-icon.svg
I agree to release my text and image contributions, unless otherwise stated, into the public domain. Please be aware that other contributors might not do the same, so if you want to use my contributions under public domain terms, please check the multi-licensing guide.

User:Menasim/Userboxes/User anything

Template:Userpage